PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28650.m000186
Common NameRCOM_0300290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 663aa    MW: 75257.7 Da    PI: 6.2991
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28650.m000186genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.46.6e-1112906593374
           GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    ++L +cA+av+++d++ a++lL ++++ +sp gd +qRla++f+++L+arla++++  y+    s+ts    +  l+a++++  ++P+ ++shl a
  28650.m000186 290 TVLPQCAQAVANDDQTTAKELLRQIKQYSSPFGDGNQRLAHFFANGLEARLAGTGTPGYAPAVNSTTS---AAGMLKAYHAYTTACPFQTMSHLYA 382
                    5789*************************************************888888777666666...8999********************* PP

           GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    N++I++ +e+ +r+HiiDf+i +G+QWp+L++ L++R +gpp+l iTg++ p++g   +e++eetg+rL+k++e+++vpfe++  +a+++e++++e
  28650.m000186 383 NETIMKLAEKTTRLHIIDFGILYGFQWPCLIEDLSTRHGGPPRLHITGIEFPQPGfrPAERVEETGRRLSKYCERFNVPFEYDS-IAQNWESIQYE 477
                    ******************************************************9*****************************.7********** PP

           GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                    +++++++E+++Vn+ ++l++++d+++ ++s rd++Lkl+++++P+++++   +  +n++ Fl+rf +al ++salfd++++++pre+ er++ E+e
  28650.m000186 478 DFKIDRNEMIVVNCLYRLKNIPDDTMVVNSMRDSILKLMRRINPDIFIHGVVNGTYNAPFFLTRFRDALFHFSALFDMIDSTIPREEPERMMFEKE 573
                    ************************************************************************************************ PP

           GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    ++gr +vnv+aceg er+er et+++W++r  +aGF+++pl+++++k++ + ++  +++ + v+e+s+++++gWk+r ++++ +W+
  28650.m000186 574 VFGRYAVNVIACEGGERVERPETYRQWQARNIRAGFRQLPLDQEIMKKVITTVKSNYNKNFIVDEDSQWMLQGWKGRIIYALAVWK 659
                    *********************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.767262639IPR005202Transcription factor GRAS
PfamPF035142.3E-108290659IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MDDALLRAPP GAMSGFRFEY GTMSVLPNQH LVNGFKLNHS SVVDPYRSLH PKNAHALSSD  60
SATSTSSSFE LDSPDNSDIS NVVLKYISDM LMEEELESKN FMFEDCLALQ AAEKSFYDVL  120
GQKYPASLDQ SPFLDQNIHS LEGTSTWCGC GSHLENAIQV PDLYCRSFSN DDSLLLSESQ  180
TKDYARGCCS FSSSRDRKHH QREESACVEG RSNKHSAFSV EQPEDTKIFD EVLLCQARNN  240
DSASCVPQNA LQGGGDGQEK NHGRTEGSNR RTARTKKRGS NKRDMMDLWT VLPQCAQAVA  300
NDDQTTAKEL LRQIKQYSSP FGDGNQRLAH FFANGLEARL AGTGTPGYAP AVNSTTSAAG  360
MLKAYHAYTT ACPFQTMSHL YANETIMKLA EKTTRLHIID FGILYGFQWP CLIEDLSTRH  420
GGPPRLHITG IEFPQPGFRP AERVEETGRR LSKYCERFNV PFEYDSIAQN WESIQYEDFK  480
IDRNEMIVVN CLYRLKNIPD DTMVVNSMRD SILKLMRRIN PDIFIHGVVN GTYNAPFFLT  540
RFRDALFHFS ALFDMIDSTI PREEPERMMF EKEVFGRYAV NVIACEGGER VERPETYRQW  600
QARNIRAGFR QLPLDQEIMK KVITTVKSNY NKNFIVDEDS QWMLQGWKGR IIYALAVWKP  660
VHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-492926598375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583587.10.0PREDICTED: scarecrow-like protein 9
TrEMBLB9T6790.0B9T679_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein